Lineage for d1hfna_ (1hfn A:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.9: IL8-like [54116] (2 superfamilies) Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) 
Family d.9.1.1: Interleukin 8-like chemokines [54118] (21 proteins) 
Protein Macrophage inflammatory protein, MIP [54128] (4 species) Species Kaposi's sarcoma herpes virus, VMIP-II [54131] (4 PDB entries) 
Domain d1hfna_: 1hfn A: [37408]
Details for d1hfna_
PDB Entry: 1hfn (more details)
PDB Description: nmr solution structures of vmip-ii 1-71 from kaposi's sarcoma-associated herpesvirus.
SCOP Domain Sequences for d1hfna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hfna_ d.9.1.1 (A:) Macrophage inflammatory protein, MIP {Kaposi's sarcoma herpes virus, VMIP-II}
lgaswhrpdkcclgyqkrplpqvllsswyptsqlcskpgvifltkrgrqvcadkskdwvk
klmqqlpvtar
SCOP Domain Coordinates for d1hfna_:
Click to download the PDB-style file with coordinates for d1hfna_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hfna_:
- d1hfna_ first appeared (with stable ids) in SCOP 1.55
- d1hfna_ appears in SCOP 1.57
- d1hfna_ appears in SCOP 1.61
- d1hfna_ appears in the current release, SCOPe 2.08
View in 3D