Lineage for d5zaub_ (5zau B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394630Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2394631Family b.34.13.1: "Histone-like" proteins from archaea [54161] (2 proteins)
  6. 2394652Protein automated matches [190114] (2 species)
    not a true protein
  7. 2394670Species Sulfolobus solfataricus [TaxId:2287] [337247] (4 PDB entries)
  8. 2394675Domain d5zaub_: 5zau B: [374077]
    Other proteins in same PDB: d5zaua_
    automated match to d5ufeb_

Details for d5zaub_

PDB Entry: 5zau (more details)

PDB Description: complex of the human fyn sh3 and monobody binder
PDB Compounds: (B:) Monobody Binder

SCOPe Domain Sequences for d5zaub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zaub_ b.34.13.1 (B:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
matvkfkykgeekqvdiskivfvtrygkqiffrydlgggkpgfgvvsekdapkellqkle
kqkk

SCOPe Domain Coordinates for d5zaub_:

Click to download the PDB-style file with coordinates for d5zaub_.
(The format of our PDB-style files is described here.)

Timeline for d5zaub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5zaua_