SCOPe 2.08: Domain d6e5bq_: 6e5b Q:

Lineage for d6e5bq_ (6e5b Q:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
   contains an extension to the common fold at the N-terminus

7. Species Human (Homo sapiens) [TaxId:9606] [311422] (15 PDB entries)

8. Domain d6e5bq_: 6e5b Q: [374051]
   Other proteins in same PDB: d6e5ba_, d6e5bb_, d6e5bf_, d6e5bh_, d6e5bi_, d6e5bj_, d6e5bk_, d6e5bl_, d6e5bm_, d6e5bn_, d6e5bt_, d6e5bv_, d6e5bw_, d6e5bx_, d6e5by_, d6e5bz_
   automated match to d1irud_
   complexed with huj, na, scn

Details for d6e5bq_

PDB Entry: 6e5b, 2.77 Å

PDB Description: human immunoproteasome 20s particle in complex with compound 1

PDB Compounds: (Q:) Proteasome subunit alpha type-7

SCOPe Domain Sequences for d6e5bq_:

Sequence, based on SEQRES records:

>d6e5bq_ d.153.1.4 (Q:) Proteasome alpha subunit (non-catalytic) {Human (Homo sapiens) [TaxId: 9606]}
sydraitvfspdghlfqveyaqeavkkgstavgvrgrdivvlgvekksvaklqdertvrk
icalddnvcmafagltadarivinrarvecqshrltvedpvtveyitryiaslkqrytqs
ngrrpfgisalivgfdfdgtprlyqtdpsgtyhawkanaigrgaksvrefleknytdeai
etddltiklvikallevvqsggknielavmrrdqslkilnpeeiekyvaeiekekee

Sequence, based on observed residues (ATOM records):

>d6e5bq_ d.153.1.4 (Q:) Proteasome alpha subunit (non-catalytic) {Human (Homo sapiens) [TaxId: 9606]}
sydraitvfspdghlfqveyaqeavkkgstavgvrgrdivvlgvekaklqdertvrkica
lddnvcmafagltadarivinrarvecqshrltvedpvtveyitryiaslkqrytqsngr
rpfgisalivgfdfdgtprlyqtdpsgtyhawkanaigrgaksvrefleknytdeaietd
dltiklvikallevvqsggknielavmrrdqslkilnpeeiekyvaeiekekee

Timeline for d6e5bq_:

• d6e5bq_ first appeared in SCOPe 2.07