Lineage for d6s53c_ (6s53 C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546033Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2546034Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2546035Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2546043Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2546139Species Human (Homo sapiens), ubc13 [TaxId:9606] [64240] (19 PDB entries)
  8. 2546159Domain d6s53c_: 6s53 C: [374050]
    Other proteins in same PDB: d6s53d_, d6s53f_, d6s53j_, d6s53l_
    automated match to d3w31b_
    complexed with mpd, zn

Details for d6s53c_

PDB Entry: 6s53 (more details), 2.8 Å

PDB Description: crystal structure of trim21 ring domain in complex with an isopeptide- linked ube2n~ubiquitin conjugate
PDB Compounds: (C:) Ubiquitin-conjugating enzyme E2 N

SCOPe Domain Sequences for d6s53c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6s53c_ d.20.1.1 (C:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubc13 [TaxId: 9606]}
lprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeeyp
maapkvrfmtkiyhpnvdklgrikldiladkwspalqirtvllsiqallsapnpddplan
dvaeqwktneaqaietarawtrlyamnni

SCOPe Domain Coordinates for d6s53c_:

Click to download the PDB-style file with coordinates for d6s53c_.
(The format of our PDB-style files is described here.)

Timeline for d6s53c_: