Lineage for d6rqwa_ (6rqw A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2811457Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2811458Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2812758Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2812759Protein automated matches [191011] (16 species)
    not a true protein
  7. 2812843Species Human (Homo sapiens) [TaxId:9606] [188766] (28 PDB entries)
  8. 2812849Domain d6rqwa_: 6rqw A: [374046]
    automated match to d5dvxa_
    complexed with fmt, zn

Details for d6rqwa_

PDB Entry: 6rqw (more details), 1.49 Å

PDB Description: x-ray crystal structure of perdeuterated (d) small monoclinic unit cell ca ix sv.
PDB Compounds: (A:) Carbonic anhydrase 9

SCOPe Domain Sequences for d6rqwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rqwa_ b.74.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hwryggdppwprvspacagrfqspvdirpqlaafspalrplelsgfqlpplpelrlrnng
hsvqltlppglemklgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvhlstky
arvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldisallps
dfsryfqyegslttppcaqgviwtvfnqtvslsakqlhtlsdtlwgpgdsrlqlnfratq
plngrvieasfpagvd

SCOPe Domain Coordinates for d6rqwa_:

Click to download the PDB-style file with coordinates for d6rqwa_.
(The format of our PDB-style files is described here.)

Timeline for d6rqwa_: