Lineage for d6rjcb1 (6rjc B:2-332)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2445862Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2445863Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2446296Family c.36.1.10: TK-like PP module [88760] (3 proteins)
    different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain
  6. 2446347Protein automated matches [254698] (2 species)
    not a true protein
  7. 2446348Species Escherichia coli [TaxId:83333] [324638] (4 PDB entries)
  8. 3073973Domain d6rjcb1: 6rjc B:2-332 [374035]
    Other proteins in same PDB: d6rjca2, d6rjca3, d6rjca4, d6rjcb2, d6rjcb3, d6rjcb4
    automated match to d1qgda2
    complexed with ca, edo, gol, na

Details for d6rjcb1

PDB Entry: 6rjc (more details), 1.05 Å

PDB Description: e.coli transketolase apoenzyme
PDB Compounds: (B:) Transketolase 1

SCOPe Domain Sequences for d6rjcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rjcb1 c.36.1.10 (B:2-332) automated matches {Escherichia coli [TaxId: 83333]}
ssrkelanairalsmdavqkaksghpgapmgmadiaevlwrdflkhnpqnpswadrdrfv
lsnghgsmliysllhltgydlpmeelknfrqlhsktpghpevgytagvetttgplgqgia
navgmaiaektlaaqfnrpghdivdhytyafmgdgcmmegishevcslagtlklgkliaf
yddngisidghvegwftddtamrfeaygwhvirdidghdaasikraveearavtdkpsll
mcktiigfgspnkagthdshgaplgdaeialtreqlgwkyapfeipseiyaqwdakeagq
akesawnekfaayakaypqeaaeftrrmkge

SCOPe Domain Coordinates for d6rjcb1:

Click to download the PDB-style file with coordinates for d6rjcb1.
(The format of our PDB-style files is described here.)

Timeline for d6rjcb1:

  • d6rjcb1 is new in SCOPe 2.07-stable