Lineage for d1b53a_ (1b53 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 597802Fold d.9: IL8-like [54116] (1 superfamily)
    beta(3)-alpha
  4. 597803Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
    form dimers with different dimerisation modes
  5. 597804Family d.9.1.1: Interleukin 8-like chemokines [54118] (24 proteins)
  6. 597872Protein Macrophage inflammatory protein, MIP [54128] (5 species)
    has different dimerisation mode
  7. 597873Species Human (Homo sapiens), 1-alpha [TaxId:9606] [54130] (2 PDB entries)
  8. 597876Domain d1b53a_: 1b53 A: [37403]

Details for d1b53a_

PDB Entry: 1b53 (more details)

PDB Description: nmr structure of human mip-1a d26a, minimized average structure

SCOP Domain Sequences for d1b53a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b53a_ d.9.1.1 (A:) Macrophage inflammatory protein, MIP {Human (Homo sapiens), 1-alpha}
slaadtptaccfsytsrqipqnfiaayfetssqcskpgvifltkrsrqvcadpseewvqk
yvsdlelsa

SCOP Domain Coordinates for d1b53a_:

Click to download the PDB-style file with coordinates for d1b53a_.
(The format of our PDB-style files is described here.)

Timeline for d1b53a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b53b_