SCOP 1.71: Domain d1b53a_: 1b53 A:

Lineage for d1b53a_ (1b53 A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.9: IL8-like [54116] (1 superfamily)
   beta(3)-alpha

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family)
   form dimers with different dimerisation modes

5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (24 proteins)

6. Protein Macrophage inflammatory protein, MIP [54128] (5 species)
   has different dimerisation mode

7. Species Human (Homo sapiens), 1-alpha [TaxId:9606] [54130] (2 PDB entries)

8. Domain d1b53a_: 1b53 A: [37403]

Details for d1b53a_

PDB Entry: 1b53

PDB Description: nmr structure of human mip-1a d26a, minimized average structure

SCOP Domain Sequences for d1b53a_:

Sequence; same for both SEQRES and ATOM records:

>d1b53a_ d.9.1.1 (A:) Macrophage inflammatory protein, MIP {Human (Homo sapiens), 1-alpha}
slaadtptaccfsytsrqipqnfiaayfetssqcskpgvifltkrsrqvcadpseewvqk
yvsdlelsa

Timeline for d1b53a_:

• d1b53a_ first appeared (with stable ids) in SCOP 1.55
  
• d1b53a_ appears in SCOP 1.69
  
• d1b53a_ appears in SCOP 1.73
  
• d1b53a_ appears in the current release, SCOPe 2.08