![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.9: IL8-like [54116] (1 superfamily) beta(3)-alpha |
![]() | Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) ![]() form dimers with different dimerisation modes |
![]() | Family d.9.1.1: Interleukin 8-like chemokines [54118] (24 proteins) |
![]() | Protein Macrophage inflammatory protein, MIP [54128] (5 species) has different dimerisation mode |
![]() | Species Human (Homo sapiens), 1-alpha [TaxId:9606] [54130] (2 PDB entries) |
![]() | Domain d1b53a_: 1b53 A: [37403] |
PDB Entry: 1b53 (more details)
SCOP Domain Sequences for d1b53a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b53a_ d.9.1.1 (A:) Macrophage inflammatory protein, MIP {Human (Homo sapiens), 1-alpha} slaadtptaccfsytsrqipqnfiaayfetssqcskpgvifltkrsrqvcadpseewvqk yvsdlelsa
Timeline for d1b53a_: