SCOPe 2.08: Domain d6rd3f1: 6rd3 F:1-344

Lineage for d6rd3f1 (6rd3 F:1-344)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.4.3: Porins [56935] (5 families)

5. Family f.4.3.1: Porin [56936] (2 proteins)
   trimer, one subunit folds into (16,20) barrel

6. Protein automated matches [190289] (7 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [340493] (7 PDB entries)

8. Domain d6rd3f1: 6rd3 F:1-344 [374020]
   Other proteins in same PDB: d6rd3a2, d6rd3b2, d6rd3c2, d6rd3d2, d6rd3e2, d6rd3f2
   automated match to d1osma_
   complexed with c8e, mg

Details for d6rd3f1

PDB Entry: 6rd3, 1.98 Å

PDB Description: crystal structure of the wild type ompk36 from klebsiella pneumonia

PDB Compounds: (F:) ompk36

SCOPe Domain Sequences for d6rd3f1:

Sequence; same for both SEQRES and ATOM records:

>d6rd3f1 f.4.3.1 (F:1-344) automated matches {Klebsiella pneumoniae [TaxId: 573]}
aeiynkdgnkldlygkidglhyfsddksvdgdqtymrvgvkgetqindqltgygqweynv
qanntesssdqawtrlafaglkfgdagsfdygrnygvvydvtswtdvlpefggdtygsdn
flqsrangvatyrnsdffglvdglnfalqyqgkngsvsgegatnngrgwskqngdgfgts
ltydiwdgisagfayshskrtdeqnsvpalgrgdnaetytgglkydanniylasqytqty
natragslgfankaqnfevvaqyqfdfglrpsvaylqskgkdlergygdqdilkyvdvga
tyyfnknmstyvdykinllddnsftrnagistddvvalglvyqf

Timeline for d6rd3f1:

• d6rd3f1 first appeared in SCOPe 2.07