Lineage for d1b50b_ (1b50 B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1400629Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 1400630Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 1400631Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 1400699Protein Macrophage inflammatory protein, MIP [54128] (5 species)
    has different dimerisation mode
  7. 1400700Species Human (Homo sapiens), 1-alpha [TaxId:9606] [54130] (3 PDB entries)
  8. 1400722Domain d1b50b_: 1b50 B: [37402]

Details for d1b50b_

PDB Entry: 1b50 (more details)

PDB Description: nmr structure of human mip-1a d26a, 10 structures
PDB Compounds: (B:) mip-1a

SCOPe Domain Sequences for d1b50b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b50b_ d.9.1.1 (B:) Macrophage inflammatory protein, MIP {Human (Homo sapiens), 1-alpha [TaxId: 9606]}
slaadtptaccfsytsrqipqnfiaayfetssqcskpgvifltkrsrqvcadpseewvqk
yvsdlelsa

SCOPe Domain Coordinates for d1b50b_:

Click to download the PDB-style file with coordinates for d1b50b_.
(The format of our PDB-style files is described here.)

Timeline for d1b50b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b50a_