Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
Fold d.9: IL8-like [54116] (2 superfamilies) |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) |
Family d.9.1.1: Interleukin 8-like chemokines [54118] (22 proteins) |
Protein Macrophage inflammatory protein, MIP [54128] (5 species) |
Species Human (Homo sapiens), 1-alpha [TaxId:9606] [54130] (2 PDB entries) |
Domain d1b50b_: 1b50 B: [37402] |
PDB Entry: 1b50 (more details)
SCOP Domain Sequences for d1b50b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b50b_ d.9.1.1 (B:) Macrophage inflammatory protein, MIP {Human (Homo sapiens), 1-alpha} slaadtptaccfsytsrqipqnfiaayfetssqcskpgvifltkrsrqvcadpseewvqk yvsdlelsa
Timeline for d1b50b_: