Lineage for d1b50a_ (1b50 A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30036Fold d.9: IL8-like [54116] (2 superfamilies)
  4. 30037Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
  5. 30038Family d.9.1.1: Interleukin 8-like chemokines [54118] (19 proteins)
  6. 30090Protein Macrophage inflammatory protein, MIP [54128] (3 species)
  7. 30091Species Human (Homo sapiens), 1-alpha [TaxId:9606] [54130] (2 PDB entries)
  8. 30092Domain d1b50a_: 1b50 A: [37401]

Details for d1b50a_

PDB Entry: 1b50 (more details)

PDB Description: nmr structure of human mip-1a d26a, 10 structures

SCOP Domain Sequences for d1b50a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b50a_ d.9.1.1 (A:) Macrophage inflammatory protein, MIP {Human (Homo sapiens), 1-alpha}
slaadtptaccfsytsrqipqnfiaayfetssqcskpgvifltkrsrqvcadpseewvqk
yvsdlelsa

SCOP Domain Coordinates for d1b50a_:

Click to download the PDB-style file with coordinates for d1b50a_.
(The format of our PDB-style files is described here.)

Timeline for d1b50a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b50b_