Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) form dimers with different dimerisation modes |
Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins) |
Protein Macrophage inflammatory protein, MIP [54128] (5 species) has different dimerisation mode |
Species Human (Homo sapiens), 1-alpha [TaxId:9606] [54130] (3 PDB entries) |
Domain d1b50a_: 1b50 A: [37401] |
PDB Entry: 1b50 (more details)
SCOPe Domain Sequences for d1b50a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b50a_ d.9.1.1 (A:) Macrophage inflammatory protein, MIP {Human (Homo sapiens), 1-alpha [TaxId: 9606]} slaadtptaccfsytsrqipqnfiaayfetssqcskpgvifltkrsrqvcadpseewvqk yvsdlelsa
Timeline for d1b50a_: