| Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
| Fold d.9: IL8-like [54116] (2 superfamilies) |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) ![]() |
| Family d.9.1.1: Interleukin 8-like chemokines [54118] (21 proteins) |
| Protein Macrophage inflammatory protein, MIP [54128] (4 species) |
| Species Human (Homo sapiens), 1-beta [TaxId:9606] [54129] (3 PDB entries) |
| Domain d1huna_: 1hun A: [37399] |
PDB Entry: 1hun (more details)
SCOP Domain Sequences for d1huna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1huna_ d.9.1.1 (A:) Macrophage inflammatory protein, MIP {Human (Homo sapiens), 1-beta}
apmgsdpptaccfsytarklprnfvvdyyetsslcsqpavvfqtkrskqvcadpseswvq
eyvydleln
Timeline for d1huna_: