SCOPe 2.07: Domain d6i1sb1: 6i1s B:1-108

Lineage for d6i1sb1 (6i1s B:1-108)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225017] (17 PDB entries)

8. Domain d6i1sb1: 6i1s B:1-108 [373986]
   Other proteins in same PDB: d6i1sa1, d6i1sa2, d6i1sb2
   automated match to d4c02b_
   complexed with e26, edo, so4

Details for d6i1sb1

PDB Entry: 6i1s, 1.52 Å

PDB Description: crystal structure of the acvr1 (alk2) kinase in complex with fkbp12 and the inhibitor e6201

PDB Compounds: (B:) Peptidyl-prolyl cis-trans isomerase FKBP1A

SCOPe Domain Sequences for d6i1sb1:

Sequence; same for both SEQRES and ATOM records:

>d6i1sb1 d.26.1.0 (B:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgw
eegvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

Timeline for d6i1sb1:

• d6i1sb1 is new in SCOPe 2.07-stable
  
• d6i1sb1 appears in the current release, SCOPe 2.08