SCOPe 2.07: Domain d6mcyb1: 6mcy B:21-182

Lineage for d6mcyb1 (6mcy B:21-182)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.0: automated matches [195065] (1 protein)
   not a true family

6. Protein automated matches [195066] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [195067] (5 PDB entries)

8. Domain d6mcyb1: 6mcy B:21-182 [373983]
   Other proteins in same PDB: d6mcya2, d6mcyb2, d6mcyc2, d6mcyd2
   automated match to d2imta_
   complexed with edo, fmt

Details for d6mcyb1

PDB Entry: 6mcy, 1.75 Å

PDB Description: crystal structure of mouse bak

PDB Compounds: (B:) bcl-2 homologous antagonist/killer

SCOPe Domain Sequences for d6mcyb1:

Sequence; same for both SEQRES and ATOM records:

>d6mcyb1 f.1.4.0 (B:21-182) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
seqqvaqdteevfrsyvfylhqqeqetqgaaapanpemdnlplepnsilgqvgrqlalig
ddinrrydtefqnlleqlqptagnayelftkiasslfksgiswgrvvallgfgyrlalyv
yqrgltgflgqvtsfladiilhhyiarwiaqrggwvaalnfr

Timeline for d6mcyb1:

• d6mcyb1 is new in SCOPe 2.07-stable
  
• d6mcyb1 appears in the current release, SCOPe 2.08