Lineage for d1humb_ (1hum B:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 130488Fold d.9: IL8-like [54116] (2 superfamilies)
  4. 130489Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
  5. 130490Family d.9.1.1: Interleukin 8-like chemokines [54118] (21 proteins)
  6. 130546Protein Macrophage inflammatory protein, MIP [54128] (4 species)
  7. 130552Species Human (Homo sapiens), 1-beta [TaxId:9606] [54129] (3 PDB entries)
  8. 130557Domain d1humb_: 1hum B: [37398]

Details for d1humb_

PDB Entry: 1hum (more details)

PDB Description: solution structure of the chemokine hmip-1beta(slash)act-2 by multi- dimensional nmr: a novel chemokine dimer

SCOP Domain Sequences for d1humb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1humb_ d.9.1.1 (B:) Macrophage inflammatory protein, MIP {Human (Homo sapiens), 1-beta}
apmgsdpptaccfsytarklprnfvvdyyetsslcsqpavvfqtkrskqvcadpseswvq
eyvydleln

SCOP Domain Coordinates for d1humb_:

Click to download the PDB-style file with coordinates for d1humb_.
(The format of our PDB-style files is described here.)

Timeline for d1humb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1huma_