![]() | Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
![]() | Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
![]() | Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) ![]() PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
![]() | Family f.1.4.0: automated matches [195065] (1 protein) not a true family |
![]() | Protein automated matches [195066] (5 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [195067] (5 PDB entries) |
![]() | Domain d6mcyd1: 6mcy D:21-181 [373971] Other proteins in same PDB: d6mcya2, d6mcyb2, d6mcyc2, d6mcyd2 automated match to d2imta_ complexed with edo, fmt |
PDB Entry: 6mcy (more details), 1.75 Å
SCOPe Domain Sequences for d6mcyd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6mcyd1 f.1.4.0 (D:21-181) automated matches {Mouse (Mus musculus) [TaxId: 10090]} seqqvaqdteevfrsyvfylhqqeqetqgaaapanpemdnlplepnsilgqvgrqlalig ddinrrydtefqnlleqlqptagnayelftkiasslfksgiswgrvvallgfgyrlalyv yqrgltgflgqvtsfladiilhhyiarwiaqrggwvaalnf
Timeline for d6mcyd1: