SCOPe 2.07: Domain d6jpkb_: 6jpk B:

Lineage for d6jpkb_ (6jpk B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (160 species)
   not a true protein

7. Species Schizosaccharomyces pombe [TaxId:284812] [373969] (1 PDB entry)

8. Domain d6jpkb_: 6jpk B: [373970]
   Other proteins in same PDB: d6jpka2
   automated match to d3meba_
   complexed with gol, po4

Details for d6jpkb_

PDB Entry: 6jpk, 2.1 Å

PDB Description: crystal structure of s. pombe aspartate aminotransferase

PDB Compounds: (B:) Aspartate aminotransferase, cytoplasmic

SCOPe Domain Sequences for d6jpkb_:

Sequence; same for both SEQRES and ATOM records:

>d6jpkb_ c.67.1.0 (B:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
sdygfanieeakadaifklnaqyhqdedpkkvnmsvgayrddtgkpwilpavkkaskive
eqasfnheylpiaglprftkaaaevlfrpnphllsedrvasmqsvsgtganflaasfiet
fyvkhtgahvyisnptwpvhrtlweklgvtvetypywdaknrsfdyegmlstiksapegs
ifllhacahnptgidptreqwlsifesllsrkhlvvfdiayqgfasgdlnrdswalnefv
kynkdffvcqsfaknmglygertgcmhyvakdastknkvlsqlcivqrntisnppaygar
iaaeilnspqlfaeweqdlktmssriiemrkrlrdslvalktpgswdhitqqigmfsftg
ltpaqvqfcqeryhlyfsangrismaglnnsnvehvaqafnhavrelp

Timeline for d6jpkb_:

• d6jpkb_ is new in SCOPe 2.07-stable
  
• d6jpkb_ appears in the current release, SCOPe 2.08