SCOPe 2.06: Domain d1huma_: 1hum A:

Lineage for d1huma_ (1hum A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)
   beta(3)-alpha

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families)
   form dimers with different dimerisation modes

5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)

6. Protein Macrophage inflammatory protein, MIP [54128] (5 species)
   has different dimerisation mode

7. Species Human (Homo sapiens), 1-beta [TaxId:9606] [54129] (6 PDB entries)

8. Domain d1huma_: 1hum A: [37397]

Details for d1huma_

PDB Entry: 1hum

PDB Description: solution structure of the chemokine hmip-1beta(slash)act-2 by multi- dimensional nmr: a novel chemokine dimer

PDB Compounds: (A:) human macrophage inflammatory protein 1 beta

SCOPe Domain Sequences for d1huma_:

Sequence; same for both SEQRES and ATOM records:

>d1huma_ d.9.1.1 (A:) Macrophage inflammatory protein, MIP {Human (Homo sapiens), 1-beta [TaxId: 9606]}
apmgsdpptaccfsytarklprnfvvdyyetsslcsqpavvfqtkrskqvcadpseswvq
eyvydleln

Timeline for d1huma_:

• d1huma_ first appeared (with stable ids) in SCOP 1.55
  
• d1huma_ appears in SCOPe 2.05
  
• d1huma_ appears in SCOPe 2.07
  
• d1huma_ appears in the current release, SCOPe 2.08