Lineage for d1huma_ (1hum A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30036Fold d.9: IL8-like [54116] (2 superfamilies)
  4. 30037Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
  5. 30038Family d.9.1.1: Interleukin 8-like chemokines [54118] (19 proteins)
  6. 30090Protein Macrophage inflammatory protein, MIP [54128] (3 species)
  7. 30096Species Human (Homo sapiens), 1-beta [TaxId:9606] [54129] (2 PDB entries)
  8. 30097Domain d1huma_: 1hum A: [37397]

Details for d1huma_

PDB Entry: 1hum (more details)

PDB Description: solution structure of the chemokine hmip-1beta(slash)act-2 by multi- dimensional nmr: a novel chemokine dimer

SCOP Domain Sequences for d1huma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1huma_ d.9.1.1 (A:) Macrophage inflammatory protein, MIP {Human (Homo sapiens), 1-beta}
apmgsdpptaccfsytarklprnfvvdyyetsslcsqpavvfqtkrskqvcadpseswvq
eyvydleln

SCOP Domain Coordinates for d1huma_:

Click to download the PDB-style file with coordinates for d1huma_.
(The format of our PDB-style files is described here.)

Timeline for d1huma_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1humb_