Lineage for d1rodb_ (1rod B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2175338Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2175339Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2175340Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2175370Protein IL-8/MGSA chimeric protein CIL-8M [54126] (1 species)
    IL-8: residues 1-53; MGSA: residues 54-72
  7. 2175371Species Human (Homo sapiens) [TaxId:9606] [54127] (1 PDB entry)
  8. 2175373Domain d1rodb_: 1rod B: [37396]

Details for d1rodb_

PDB Entry: 1rod (more details)

PDB Description: chimeric protein of interleukin 8 and human melanoma growth stimulating activity protein, nmr
PDB Compounds: (B:) chimeric protein of interleukin 8 and human melanoma growth stimulating activity protein

SCOPe Domain Sequences for d1rodb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rodb_ d.9.1.1 (B:) IL-8/MGSA chimeric protein CIL-8M {Human (Homo sapiens) [TaxId: 9606]}
sakelrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpaspivkk
iiekmlnsdksn

SCOPe Domain Coordinates for d1rodb_:

Click to download the PDB-style file with coordinates for d1rodb_.
(The format of our PDB-style files is described here.)

Timeline for d1rodb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1roda_