SCOPe 2.06: Domain d1rodb_: 1rod B:

Lineage for d1rodb_ (1rod B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)
   beta(3)-alpha

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families)
   form dimers with different dimerisation modes

5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)

6. Protein IL-8/MGSA chimeric protein CIL-8M [54126] (1 species)
   IL-8: residues 1-53; MGSA: residues 54-72

7. Species Human (Homo sapiens) [TaxId:9606] [54127] (1 PDB entry)

8. Domain d1rodb_: 1rod B: [37396]

Details for d1rodb_

PDB Entry: 1rod

PDB Description: chimeric protein of interleukin 8 and human melanoma growth stimulating activity protein, nmr

PDB Compounds: (B:) chimeric protein of interleukin 8 and human melanoma growth stimulating activity protein

SCOPe Domain Sequences for d1rodb_:

Sequence; same for both SEQRES and ATOM records:

>d1rodb_ d.9.1.1 (B:) IL-8/MGSA chimeric protein CIL-8M {Human (Homo sapiens) [TaxId: 9606]}
sakelrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpaspivkk
iiekmlnsdksn

Timeline for d1rodb_:

• d1rodb_ first appeared (with stable ids) in SCOP 1.55
  
• d1rodb_ appears in SCOPe 2.05
  
• d1rodb_ appears in SCOPe 2.07
  
• d1rodb_ appears in the current release, SCOPe 2.08