![]() | Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
![]() | Fold d.9: IL8-like [54116] (2 superfamilies) |
![]() | Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) ![]() |
![]() | Family d.9.1.1: Interleukin 8-like chemokines [54118] (22 proteins) |
![]() | Protein IL-8/MGSA chimeric protein CIL-8M [54126] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54127] (1 PDB entry) |
![]() | Domain d1rodb_: 1rod B: [37396] |
PDB Entry: 1rod (more details)
SCOP Domain Sequences for d1rodb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rodb_ d.9.1.1 (B:) IL-8/MGSA chimeric protein CIL-8M {Human (Homo sapiens)} sakelrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpaspivkk iiekmlnsdksn
Timeline for d1rodb_: