Lineage for d1roda_ (1rod A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 188772Fold d.9: IL8-like [54116] (2 superfamilies)
  4. 188773Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
  5. 188774Family d.9.1.1: Interleukin 8-like chemokines [54118] (22 proteins)
  6. 188807Protein IL-8/MGSA chimeric protein CIL-8M [54126] (1 species)
  7. 188808Species Human (Homo sapiens) [TaxId:9606] [54127] (1 PDB entry)
  8. 188809Domain d1roda_: 1rod A: [37395]

Details for d1roda_

PDB Entry: 1rod (more details)

PDB Description: chimeric protein of interleukin 8 and human melanoma growth stimulating activity protein, nmr

SCOP Domain Sequences for d1roda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1roda_ d.9.1.1 (A:) IL-8/MGSA chimeric protein CIL-8M {Human (Homo sapiens)}
sakelrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpaspivkk
iiekmlnsdksn

SCOP Domain Coordinates for d1roda_:

Click to download the PDB-style file with coordinates for d1roda_.
(The format of our PDB-style files is described here.)

Timeline for d1roda_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rodb_