Lineage for d1roda_ (1rod A:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.9: IL8-like [54116] (2 superfamilies) Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) 
Family d.9.1.1: Interleukin 8-like chemokines [54118] (19 proteins) 
Protein IL-8/MGSA chimeric protein CIL-8M [54126] (1 species) Species Human (Homo sapiens) [TaxId:9606] [54127] (1 PDB entry) 
Domain d1roda_: 1rod A: [37395]
Details for d1roda_
PDB Entry: 1rod (more details)
PDB Description: chimeric protein of interleukin 8 and human melanoma growth stimulating activity protein, nmr
SCOP Domain Sequences for d1roda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1roda_ d.9.1.1 (A:) IL-8/MGSA chimeric protein CIL-8M {Human (Homo sapiens)}
sakelrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpaspivkk
iiekmlnsdksn
SCOP Domain Coordinates for d1roda_:
Click to download the PDB-style file with coordinates for d1roda_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1roda_:
- d1roda_ appears in SCOP 1.57
- d1roda_ appears in the current release, SCOPe 2.08
View in 3D
