Lineage for d1roda_ (1rod A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2156493Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2156494Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2156495Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 protein domains)
  6. 2156525Protein IL-8/MGSA chimeric protein CIL-8M [54126] (1 species)
    IL-8: residues 1-53; MGSA: residues 54-72
  7. 2156526Species Human (Homo sapiens) [TaxId:9606] [54127] (1 PDB entry)
  8. 2156527Domain d1roda_: 1rod A: [37395]

Details for d1roda_

PDB Entry: 1rod (more details)

PDB Description: chimeric protein of interleukin 8 and human melanoma growth stimulating activity protein, nmr
PDB Compounds: (A:) chimeric protein of interleukin 8 and human melanoma growth stimulating activity protein

SCOPe Domain Sequences for d1roda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1roda_ d.9.1.1 (A:) IL-8/MGSA chimeric protein CIL-8M {Human (Homo sapiens) [TaxId: 9606]}
sakelrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpaspivkk
iiekmlnsdksn

SCOPe Domain Coordinates for d1roda_:

Click to download the PDB-style file with coordinates for d1roda_.
(The format of our PDB-style files is described here.)

Timeline for d1roda_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rodb_