Lineage for d6j1na2 (6j1n A:238-391)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917365Species Anisodus acutangulus [TaxId:402998] [373942] (2 PDB entries)
  8. 2917371Domain d6j1na2: 6j1n A:238-391 [373948]
    automated match to d3wd8a2
    complexed with b7x

Details for d6j1na2

PDB Entry: 6j1n (more details), 2.53 Å

PDB Description: anisodus acutangulus type iii polyketide sythase aapks2 in complex with 4-carboxy-3-oxobutanoyl-coa
PDB Compounds: (A:) A. acutangulus PKS2

SCOPe Domain Sequences for d6j1na2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j1na2 c.95.1.0 (A:238-391) automated matches {Anisodus acutangulus [TaxId: 402998]}
vfeivsaaqtfvpngdchlalhlremgltfhctkdvpptiaknvescltkaleplgisdw
nslfwilhpggnaivdqvenklgleheklratrnilrdfgnmssacvlfildeirkksar
dglkttgegldfgvllsfgpgltietvvlhskpi

SCOPe Domain Coordinates for d6j1na2:

Click to download the PDB-style file with coordinates for d6j1na2.
(The format of our PDB-style files is described here.)

Timeline for d6j1na2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6j1na1