SCOPe 2.07: Domain d6id6a1: 6id6 A:11-311

Lineage for d6id6a1 (6id6 A:11-311)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (81 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [332505] (2 PDB entries)

8. Domain d6id6a1: 6id6 A:11-311 [373945]
   Other proteins in same PDB: d6id6a2
   automated match to d2ckda1
   complexed with mg, pge

Details for d6id6a1

PDB Entry: 6id6, 1.63 Å

PDB Description: crystal structure of rv0731c from mycobacterium tuberculosis at 1.63 angstroms.

PDB Compounds: (A:) Putative S-adenosyl-L-methionine-dependent methyltransferase Rv0731c

SCOPe Domain Sequences for d6id6a1:

Sequence; same for both SEQRES and ATOM records:

>d6id6a1 c.66.1.0 (A:11-311) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
gdswdlassvgltatmvaaaravagrapgalvndqfaeplvravgvdffvrmasgeldpd
elaedeanglrrfadamairthyfdnffldatragirqavilasgldsrayrlrwpagti
vfevdqpqvidfktttlaglgaapttdrrtvavdlrddwptalqkagfdnaqrtawiaeg
llgylsaeaqdrlldqitaqsvpgsqfatevlrdinrlneeelrgrmrrlaerfrrhgld
ldmsglvyfgdrtdartyladhgwrtasasttdllaehglppidgddapfgeviyvsael
k

Timeline for d6id6a1:

• d6id6a1 is new in SCOPe 2.07-stable
  
• d6id6a1 appears in the current release, SCOPe 2.08