Lineage for d6icec_ (6ice C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2960762Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2960763Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2961019Family d.80.1.3: MIF-related [55339] (3 proteins)
    automatically mapped to Pfam PF01187
  6. 2961412Protein automated matches [373933] (1 species)
    not a true protein
  7. 2961413Species Golden hamster (Mesocricetus auratus) [TaxId:10036] [373934] (1 PDB entry)
  8. 2961416Domain d6icec_: 6ice C: [373938]
    Other proteins in same PDB: d6icea2
    automated match to d1gifa_

Details for d6icec_

PDB Entry: 6ice (more details), 1.8 Å

PDB Description: crystal structure of hamster mif
PDB Compounds: (C:) macrophage migration inhibitory factor

SCOPe Domain Sequences for d6icec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6icec_ d.80.1.3 (C:) automated matches {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}
pmftvntnvprasvpegllseltqqlaqatgkpaqyiavhvvpdqlmtfsgssdpcalcs
lhsigkiggaqnrtyskllcglladrlhispdriyinyydmsaanvgwngstfa

SCOPe Domain Coordinates for d6icec_:

Click to download the PDB-style file with coordinates for d6icec_.
(The format of our PDB-style files is described here.)

Timeline for d6icec_: