Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) |
Family d.80.1.3: MIF-related [55339] (3 proteins) automatically mapped to Pfam PF01187 |
Protein automated matches [373933] (1 species) not a true protein |
Species Golden hamster (Mesocricetus auratus) [TaxId:10036] [373934] (1 PDB entry) |
Domain d6icec_: 6ice C: [373938] Other proteins in same PDB: d6icea2 automated match to d1gifa_ |
PDB Entry: 6ice (more details), 1.8 Å
SCOPe Domain Sequences for d6icec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6icec_ d.80.1.3 (C:) automated matches {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} pmftvntnvprasvpegllseltqqlaqatgkpaqyiavhvvpdqlmtfsgssdpcalcs lhsigkiggaqnrtyskllcglladrlhispdriyinyydmsaanvgwngstfa
Timeline for d6icec_: