SCOPe 2.07: Domain d6i40a_: 6i40 A:

Lineage for d6i40a_ (6i40 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Neuroglobin [100978] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [109625] (36 PDB entries)
   Uniprot Q9ER97

8. Domain d6i40a_: 6i40 A: [373936]
   automated match to d1oj6d_
   complexed with act, cmo, fmt, gol, hem

Details for d6i40a_

PDB Entry: 6i40, 1.9 Å

PDB Description: crystal structure of murine neuroglobin bound to co at 15k under illumination using optical fiber

PDB Compounds: (A:) neuroglobin

SCOPe Domain Sequences for d6i40a_:

Sequence; same for both SEQRES and ATOM records:

>d6i40a_ a.1.1.2 (A:) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]}
rpeselirqswrvvsrsplehgtvlfarlfalepsllplfqyngrqfsspedslsspefl
dhirkvmlvidaavtnvedlssleeyltslgrkhravgvrlssfstvgesllymlekslg
pdftpatrtawsrlygavvqamsrgwdg

Timeline for d6i40a_:

• d6i40a_ is new in SCOPe 2.07-stable
  
• d6i40a_ appears in the current release, SCOPe 2.08