Class b: All beta proteins [48724] (178 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.1: Sialidases [50939] (3 families) |
Family b.68.1.0: automated matches [191452] (1 protein) not a true family |
Protein automated matches [190692] (20 species) not a true protein |
Species Influenza a virus (a/texas/17/2009(h1n1)) [TaxId:649885] [362692] (2 PDB entries) |
Domain d6hp0d_: 6hp0 D: [373928] automated match to d5huga_ complexed with bma, ca, edo, fuc, gjt, man, nag, pge |
PDB Entry: 6hp0 (more details), 1.88 Å
SCOPe Domain Sequences for d6hp0d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6hp0d_ b.68.1.0 (D:) automated matches {Influenza a virus (a/texas/17/2009(h1n1)) [TaxId: 649885]} svklagnsslcpvsgwaiyskdnsvrigskgdvfvirepfiscsplecrtffltqgalln dkhsngtikdrspyrtlmscpigevpspynsrfesvawsasachdginwltigisgpdng avavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifriekg kivksvemnapnyhyeecscypdsseitcvcrdnwhgsnrpwvsfnqnleyqigyicsgi fgdnprpndktgscgpvssngangvkgfsfkygngvwigrtksissrngfemiwdpngwt gtdnnfsikqdivginewsgysgsfvqhpeltgldcirpcfwvelirgrpkentiwtsgs sisfcgvnsdtvgwswpdgaelpftid
Timeline for d6hp0d_: