SCOPe 2.07: Domain d6sk7a_: 6sk7 A:

Lineage for d6sk7a_ (6sk7 A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.0: automated matches [191569] (1 protein)
   not a true family

6. Protein automated matches [190988] (22 species)
   not a true protein

7. Species Human rhinovirus a serotype 89 (strain 41467-gallo) [TaxId:650130] [373873] (1 PDB entry)

8. Domain d6sk7a_: 6sk7 A: [373874]
   Other proteins in same PDB: d6sk7c_
   automated match to d1d4m1_

Details for d6sk7a_

PDB Entry: 6sk7, 2.9 Å

PDB Description: cryo-em structure of rhinovirus-a89

PDB Compounds: (A:) VP1 capsid protein

SCOPe Domain Sequences for d6sk7a_:

Sequence; same for both SEQRES and ATOM records:

>d6sk7a_ b.121.4.0 (A:) automated matches {Human rhinovirus a serotype 89 (strain 41467-gallo) [TaxId: 650130]}
npvenyidsvlnevlvvpniqpstsvsshaapaldaaetghtssvqpedmietryvitdq
trdetsiesflgrsgciamiefntssdktehdkigkgfktwkvslqemaqirrkyelfty
trfdseitivtaaaaqgndsghivlqfmyvppgapvpekrddytwqsgtnasvfwqegqp
yprftipfmsiasayymfydgydgdsaaskygsvvtndmgticvrivtsnqkhdsnivcr
iyhkakhikawcprppravayqhthstnyipsngeattqiktrpd

Timeline for d6sk7a_:

• d6sk7a_ is new in SCOPe 2.07-stable
  
• d6sk7a_ appears in the current release, SCOPe 2.08