Lineage for d1pfmc_ (1pfm C:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77416Fold d.9: IL8-like [54116] (2 superfamilies)
  4. 77417Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
  5. 77418Family d.9.1.1: Interleukin 8-like chemokines [54118] (20 proteins)
  6. 77531Protein Platelet factor 4, PF4 [54121] (2 species)
  7. 77537Species Human (Homo sapiens) [TaxId:9606] [54123] (3 PDB entries)
  8. 77548Domain d1pfmc_: 1pfm C: [37387]

Details for d1pfmc_

PDB Entry: 1pfm (more details)

PDB Description: pf4-m2 chimeric mutant with the first 10 n-terminal residues of r-pf4 replaced by the n-terminal residues of the il8 sequence. models 1-15 of a 27-model set.

SCOP Domain Sequences for d1pfmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pfmc_ d.9.1.1 (C:) Platelet factor 4, PF4 {Human (Homo sapiens)}
msakelrcqcvkttsqvrprhitslevikagphcptaqliatlkngrkicldlqaplykk
iikklles

SCOP Domain Coordinates for d1pfmc_:

Click to download the PDB-style file with coordinates for d1pfmc_.
(The format of our PDB-style files is described here.)

Timeline for d1pfmc_: