Lineage for d6s8ra_ (6s8r A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2871955Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225598] (17 PDB entries)
  8. 2871970Domain d6s8ra_: 6s8r A: [373865]
    automated match to d2waxc_
    protein/RNA complex; complexed with act

Details for d6s8ra_

PDB Entry: 6s8r (more details), 2.41 Å

PDB Description: d. melanogaster rna helicase me31b in complex with gigyf
PDB Compounds: (A:) ATP-dependent RNA helicase me31b

SCOPe Domain Sequences for d6s8ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6s8ra_ c.37.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ltlkgvtqyyafvqerqkvhclntlfsklqinqsiifcnstqrvellakkitelgyccyy
ihakmaqahrnrvfhdfrqglcrnlvcsdlftrgidvqavnvvinfdfprmaetylhrig
rsgrfghlgiainlityedrfdlhriekelgteikpipkvidpalyv

SCOPe Domain Coordinates for d6s8ra_:

Click to download the PDB-style file with coordinates for d6s8ra_.
(The format of our PDB-style files is described here.)

Timeline for d6s8ra_: