SCOP 1.75: Domain d1pfnb_: 1pfn B:

Lineage for d1pfnb_ (1pfn B:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)
   beta(3)-alpha

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family)
   form dimers with different dimerisation modes

5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (24 proteins)

6. Protein Platelet factor 4, PF4 [54121] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54123] (6 PDB entries)

8. Domain d1pfnb_: 1pfn B: [37382]
   PF4-M2 chimeric mutant

Details for d1pfnb_

PDB Entry: 1pfn

PDB Description: pf4-m2 chimeric mutant with the first 10 n-terminal residues of r-pf4 replaced by the n-terminal residues of the il8 sequence. models 16-27 of a 27-model set.

PDB Compounds: (B:) pf4-m2 chimera

SCOP Domain Sequences for d1pfnb_:

Sequence; same for both SEQRES and ATOM records:

>d1pfnb_ d.9.1.1 (B:) Platelet factor 4, PF4 {Human (Homo sapiens) [TaxId: 9606]}
msakelrcqcvkttsqvrprhitslevikagphcptaqliatlkngrkicldlqaplykk
iikklles

Timeline for d1pfnb_:

• d1pfnb_ first appeared (with stable ids) in SCOP 1.55
  
• d1pfnb_ appears in SCOP 1.73
  
• d1pfnb_ appears in SCOPe 2.01
  
• d1pfnb_ appears in the current release, SCOPe 2.08