Lineage for d1rhpc_ (1rhp C:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77416Fold d.9: IL8-like [54116] (2 superfamilies)
  4. 77417Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
  5. 77418Family d.9.1.1: Interleukin 8-like chemokines [54118] (20 proteins)
  6. 77531Protein Platelet factor 4, PF4 [54121] (2 species)
  7. 77537Species Human (Homo sapiens) [TaxId:9606] [54123] (3 PDB entries)
  8. 77540Domain d1rhpc_: 1rhp C: [37379]

Details for d1rhpc_

PDB Entry: 1rhp (more details), 2.4 Å

PDB Description: crystal structure of recombinant human platelet factor 4

SCOP Domain Sequences for d1rhpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rhpc_ d.9.1.1 (C:) Platelet factor 4, PF4 {Human (Homo sapiens)}
dlqclcvkttsqvrprhitslevikagphcptaqliatlkngrkicldlqaplykkiikk
lles

SCOP Domain Coordinates for d1rhpc_:

Click to download the PDB-style file with coordinates for d1rhpc_.
(The format of our PDB-style files is described here.)

Timeline for d1rhpc_: