SCOPe 2.07: Domain d6pcud1: 6pcu D:64-223

Lineage for d6pcud1 (6pcu D:64-223)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (66 species)
   not a true protein

7. Species Rotavirus a [TaxId:28875] [277665] (11 PDB entries)

8. Domain d6pcud1: 6pcu D:64-223 [373780]
   Other proteins in same PDB: d6pcua2, d6pcub_, d6pcuc1, d6pcuc2, d6pcud2, d6pcue_, d6pcuf1, d6pcuf2, d6pcug2, d6pcuh_, d6pcui1, d6pcui2
   automated match to d2aena_
   complexed with gol, so4

Details for d6pcud1

PDB Entry: 6pcu, 2.4 Å

PDB Description: vp8* of a g2p[4] human rotavirus in complex with scfv antibody 9

PDB Compounds: (D:) Outer capsid protein VP4

SCOPe Domain Sequences for d6pcud1:

Sequence; same for both SEQRES and ATOM records:

>d6pcud1 b.29.1.0 (D:64-223) automated matches {Rotavirus a [TaxId: 28875]}
ildgpyqpttfkppndywllissntdgvvyestnnsdfwtaviavephvsqtnrqyvlfg
enkqfnvenssdkwkffemfkgssqsdfsnrrtltsnnrlvgmlkyggrvwtfhgetpra
ttdssntadlnnisiiihsefyiiprsqeskcneyinngl

Timeline for d6pcud1:

• d6pcud1 is new in SCOPe 2.07-stable
  
• d6pcud1 appears in the current release, SCOPe 2.08