SCOPe 2.08: Domain d6qvwa1: 6qvw A:156-269

Lineage for d6qvwa1 (6qvw A:156-269)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186924] (29 PDB entries)

8. Domain d6qvwa1: 6qvw A:156-269 [373777]
   Other proteins in same PDB: d6qvwa2
   automated match to d2mbfa_

Details for d6qvwa1

PDB Entry: 6qvw

PDB Description: solution structure of the free foxo1 dna binding domain

PDB Compounds: (A:) Forkhead box protein O1

SCOPe Domain Sequences for d6qvwa1:

Sequence; same for both SEQRES and ATOM records:

>d6qvwa1 a.4.5.0 (A:156-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
awgnlsyadlitkaiessaekrltlsqiyewmvksvpyfkdkgdsnssagwknsirhnls
lhskfirvqnegtgksswwmlnpeggksgksprrraasmdnnskfaksrgraak

Timeline for d6qvwa1:

• d6qvwa1 first appeared in SCOPe 2.07