Lineage for d6pxwa3 (6pxw A:312-467)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2435068Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2435137Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2435341Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 2435342Protein automated matches [190787] (12 species)
    not a true protein
  7. 2435351Species Human (Homo sapiens) [TaxId:9606] [188042] (20 PDB entries)
  8. 3073683Domain d6pxwa3: 6pxw A:312-467 [373745]
    Other proteins in same PDB: d6pxwa2, d6pxwa4, d6pxwb2, d6pxwb4
    automated match to d2dtge5

Details for d6pxwa3

PDB Entry: 6pxw (more details), 3.1 Å

PDB Description: cryo-em structure of full-length insulin receptor bound to 4 insulin. 3d refinement was focused on the top part of the receptor complex.
PDB Compounds: (A:) Insulin receptor

SCOPe Domain Sequences for d6pxwa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pxwa3 c.10.2.0 (A:312-467) automated matches {Human (Homo sapiens) [TaxId: 9606]}
chllegektidsvtsaqelrgctvingsliinirggnnlaaeleanlglieeisgylkir
rsyalvslsffrklrlirgetleignysfyaldnqnlrqlwdwskhnltitqgklffhyn
pklclseihkmeevsgtkgrqerndialktngdqas

SCOPe Domain Coordinates for d6pxwa3:

Click to download the PDB-style file with coordinates for d6pxwa3.
(The format of our PDB-style files is described here.)

Timeline for d6pxwa3:

  • d6pxwa3 is new in SCOPe 2.07-stable