Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) less regular structure consisting of variable repeats |
Family c.10.2.0: automated matches [191489] (1 protein) not a true family |
Protein automated matches [190787] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188042] (21 PDB entries) |
Domain d6pxwa3: 6pxw A:312-467 [373745] Other proteins in same PDB: d6pxwa2, d6pxwa4, d6pxwb2, d6pxwb4 automated match to d2dtge5 |
PDB Entry: 6pxw (more details), 3.1 Å
SCOPe Domain Sequences for d6pxwa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pxwa3 c.10.2.0 (A:312-467) automated matches {Human (Homo sapiens) [TaxId: 9606]} chllegektidsvtsaqelrgctvingsliinirggnnlaaeleanlglieeisgylkir rsyalvslsffrklrlirgetleignysfyaldnqnlrqlwdwskhnltitqgklffhyn pklclseihkmeevsgtkgrqerndialktngdqas
Timeline for d6pxwa3:
View in 3D Domains from other chains: (mouse over for more information) d6pxwb1, d6pxwb2, d6pxwb3, d6pxwb4 |