Class a: All alpha proteins [46456] (290 folds) |
Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily) multihelical; consists of two all-alpha subdomains |
Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (2 families) automatically mapped to Pfam PF03441 |
Family a.99.1.0: automated matches [231382] (1 protein) not a true family |
Protein automated matches [231383] (3 species) not a true protein |
Species Domestic pigeon (Columba livia) [TaxId:8932] [373723] (2 PDB entries) |
Domain d6pu0a2: 6pu0 A:206-497 [373724] Other proteins in same PDB: d6pu0a1 automated match to d4i6ga2 complexed with edo, fad, gol, peg, pge |
PDB Entry: 6pu0 (more details), 1.9 Å
SCOPe Domain Sequences for d6pu0a2:
Sequence, based on SEQRES records: (download)
>d6pu0a2 a.99.1.0 (A:206-497) automated matches {Domestic pigeon (Columba livia) [TaxId: 8932]} spwtggeteglrrleqhltdqgwvanftkprtipnsllpsttglspyfsmgclsvrtffq rlsniyaqakhhslppvslqgqllwreffytvasatqnftqmagnpiclqihwyedaerl hkwktaqtgfpwidaimtqlrqegwihhlarhavacfltrgdlwisweegmkvfeellld adysinagnwmwlsasaffhhytrifcpvrfgkrtdpegqyirkylpvlknfptkyiyep wtaseeeqrqagciigrdypfpmvnhkeasdrnlqlmrrvreeqrgtaqltr
>d6pu0a2 a.99.1.0 (A:206-497) automated matches {Domestic pigeon (Columba livia) [TaxId: 8932]} spwtggeteglrrleqhltdqgsttglspyfsmgclsvrtffqrlsniyaqakhhslppv slqgqllwreffytvasatqnftqmagnpiclqihwyedaerlhkwktaqtgfpwidaim tqlrqegwihhlarhavacfltrgdlwisweegmkvfeellldadysinagnwmwlsasa ffhhytrifcpvrfgkrtdpegqyirkylpvlknfptkyiyepwtaseeeqrqagciigr dypfpmvnhkeasdrnlqlmrrvreeqrgtaqltr
Timeline for d6pu0a2: