Lineage for d1ikm__ (1ikm -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30036Fold d.9: IL8-like [54116] (2 superfamilies)
  4. 30037Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
  5. 30038Family d.9.1.1: Interleukin 8-like chemokines [54118] (19 proteins)
  6. 30071Protein Interleukin-8, IL-8 [54119] (1 species)
  7. 30072Species Human (Homo sapiens) [TaxId:9606] [54120] (9 PDB entries)
  8. 30087Domain d1ikm__: 1ikm - [37370]

Details for d1ikm__

PDB Entry: 1ikm (more details)

PDB Description: NMR study of monomeric human interleukin-8 (30 structures)

SCOP Domain Sequences for d1ikm__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ikm__ d.9.1.1 (-) Interleukin-8, IL-8 {Human (Homo sapiens)}
elrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpkenwvqrvve
kflkraens

SCOP Domain Coordinates for d1ikm__:

Click to download the PDB-style file with coordinates for d1ikm__.
(The format of our PDB-style files is described here.)

Timeline for d1ikm__: