SCOP 1.61: Domain d1ikl__: 1ikl -

Lineage for d1ikl__ (1ikl -)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.9: IL8-like [54116] (2 superfamilies)

4. Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family)

5. Family d.9.1.1: Interleukin 8-like chemokines [54118] (22 proteins)

6. Protein Interleukin-8, IL-8 [54119] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54120] (9 PDB entries)

8. Domain d1ikl__: 1ikl - [37369]

Details for d1ikl__

PDB Entry: 1ikl

PDB Description: nmr study of monomeric human interleukin-8 (minimized average structure)

SCOP Domain Sequences for d1ikl__:

Sequence; same for both SEQRES and ATOM records:

>d1ikl__ d.9.1.1 (-) Interleukin-8, IL-8 {Human (Homo sapiens)}
elrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpkenwvqrvve
kflkraens

Timeline for d1ikl__:

• d1ikl__ first appeared (with stable ids) in SCOP 1.55
  
• d1ikl__ appears in SCOP 1.59
  
• d1ikl__ appears in SCOP 1.63
  
• d1ikl__ appears in the current release, SCOPe 2.08, called d1ikla_