Lineage for d1ilqa_ (1ilq A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2175338Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2175339Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2175340Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2175374Protein Interleukin-8, IL-8 [54119] (1 species)
  7. 2175375Species Human (Homo sapiens) [TaxId:9606] [54120] (12 PDB entries)
  8. 2175388Domain d1ilqa_: 1ilq A: [37367]

Details for d1ilqa_

PDB Entry: 1ilq (more details)

PDB Description: cxcr-1 n-terminal peptide bound to interleukin-8 (minimized mean)
PDB Compounds: (A:) interleukin-8 precursor

SCOPe Domain Sequences for d1ilqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ilqa_ d.9.1.1 (A:) Interleukin-8, IL-8 {Human (Homo sapiens) [TaxId: 9606]}
akelrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpkenwvqrv
vekflkraens

SCOPe Domain Coordinates for d1ilqa_:

Click to download the PDB-style file with coordinates for d1ilqa_.
(The format of our PDB-style files is described here.)

Timeline for d1ilqa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ilqb_