Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) form dimers with different dimerisation modes |
Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins) |
Protein Interleukin-8, IL-8 [54119] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54120] (11 PDB entries) |
Domain d1il8a_: 1il8 A: [37365] |
PDB Entry: 1il8 (more details)
SCOPe Domain Sequences for d1il8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1il8a_ d.9.1.1 (A:) Interleukin-8, IL-8 {Human (Homo sapiens) [TaxId: 9606]} akelrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpkenwvqrv vekflkraens
Timeline for d1il8a_: