Lineage for d6o0bb_ (6o0b B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869013Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2869228Protein Nitrogenase iron protein [52661] (3 species)
  7. 2869229Species Azotobacter vinelandii [TaxId:322710] [373637] (1 PDB entry)
  8. 2869231Domain d6o0bb_: 6o0b B: [373647]
    automated match to d1fp6a_
    complexed with sf4

Details for d6o0bb_

PDB Entry: 6o0b (more details), 1.6 Å

PDB Description: structural and mechanistic insights into co2 activation by nitrogenase iron protein
PDB Compounds: (B:) nitrogenase iron protein

SCOPe Domain Sequences for d6o0bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6o0bb_ c.37.1.10 (B:) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 322710]}
mrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimema
aeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddldf
vfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlgg
licnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadeyr
alarkvvdnkllvipnpitmdeleellmefgimevedesivgktaee

SCOPe Domain Coordinates for d6o0bb_:

Click to download the PDB-style file with coordinates for d6o0bb_.
(The format of our PDB-style files is described here.)

Timeline for d6o0bb_: