Lineage for d6huie_ (6hui E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2701715Protein Dodecameric ferritin homolog [47250] (16 species)
  7. 2701933Species Listeria innocua [TaxId:1642] [47252] (7 PDB entries)
  8. 2701965Domain d6huie_: 6hui E: [373634]
    automated match to d2iy4u_
    complexed with zn

Details for d6huie_

PDB Entry: 6hui (more details), 3 Å

PDB Description: the structure of dps from listeria innocua soaked with zinc
PDB Compounds: (E:) DNA protection during starvation protein

SCOPe Domain Sequences for d6huie_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6huie_ a.25.1.1 (E:) Dodecameric ferritin homolog {Listeria innocua [TaxId: 1642]}
nsvdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerl
laiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkeg
ddvtndmliafkasidkhiwmfkaflgkaple

SCOPe Domain Coordinates for d6huie_:

Click to download the PDB-style file with coordinates for d6huie_.
(The format of our PDB-style files is described here.)

Timeline for d6huie_: