Lineage for d1ilpa_ (1ilp A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30036Fold d.9: IL8-like [54116] (2 superfamilies)
  4. 30037Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
  5. 30038Family d.9.1.1: Interleukin 8-like chemokines [54118] (19 protein domains)
  6. 30071Protein Interleukin-8, IL-8 [54119] (1 species)
  7. 30072Species Human (Homo sapiens) [TaxId:9606] [54120] (9 PDB entries)
  8. 30080Domain d1ilpa_: 1ilp A: [37363]

Details for d1ilpa_

PDB Entry: 1ilp (more details)

PDB Description: cxcr-1 n-terminal peptide bound to interleukin-8

SCOP Domain Sequences for d1ilpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ilpa_ d.9.1.1 (A:) Interleukin-8, IL-8 {Human (Homo sapiens)}
akelrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpkenwvqrv
vekflkraens

SCOP Domain Coordinates for d1ilpa_:

Click to download the PDB-style file with coordinates for d1ilpa_.
(The format of our PDB-style files is described here.)

Timeline for d1ilpa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ilpb_