Lineage for d6kk8a_ (6kk8 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703769Family a.25.1.3: Manganese catalase (T-catalase) [100951] (2 proteins)
    automatically mapped to Pfam PF05067
  6. 2703792Protein automated matches [190575] (2 species)
    not a true protein
  7. 2703795Species Thermus thermophilus [TaxId:262724] [188041] (3 PDB entries)
  8. 2703800Domain d6kk8a_: 6kk8 A: [373626]
    automated match to d2v8ta_
    complexed with dod, edo, mn3, o, so4

Details for d6kk8a_

PDB Entry: 6kk8 (more details), 1.37 Å

PDB Description: xn joint refinement of manganese catalase from thermus thermophilus hb27
PDB Compounds: (A:) pseudocatalase

SCOPe Domain Sequences for d6kk8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kk8a_ a.25.1.3 (A:) automated matches {Thermus thermophilus [TaxId: 262724]}
mflridrlqielpmpkeqdpnaaaavqallggrfgemstlmnymyqsfnfrgkkalkpyy
dlianiateelghielvaatinsllaknpgkdleegvdpastplgfakdvrnaahfiagg
anslvmgamgehwngeyvftsgnlildllhnfflevaarthklrvyemtdnpvaremigy
llvrggvhaaaygkalesltgvemtkmlpipkidnskipeakkymdlgfhrnlyrfsped
yrdlgliwkgaspedgtevvvvdgpptggpvfdaghdaaefapefhpgelyeiakklye

SCOPe Domain Coordinates for d6kk8a_:

Click to download the PDB-style file with coordinates for d6kk8a_.
(The format of our PDB-style files is described here.)

Timeline for d6kk8a_: