SCOPe 2.08: Domain d6ioib1: 6ioi B:2-368

Lineage for d6ioib1 (6ioi B:2-368)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:1772] [373589] (3 PDB entries)

8. Domain d6ioib1: 6ioi B:2-368 [373619]
   Other proteins in same PDB: d6ioib2
   automated match to d5w8oa_
   complexed with coa

Details for d6ioib1

PDB Entry: 6ioi, 1.6 Å

PDB Description: crystal structure of homoserine o-acetyltransferase in complex with coa from mycobacterium smegmatis atcc 19420

PDB Compounds: (B:) Homoserine O-acetyltransferase

SCOPe Domain Sequences for d6ioib1:

Sequence; same for both SEQRES and ATOM records:

>d6ioib1 c.69.1.0 (B:2-368) automated matches {Mycobacterium smegmatis [TaxId: 1772]}
atvplpaegeiglvhigaltlengtvlpdvtiavqrwgelapdrgnvvmvlhaltgdshv
tgpagdghptagwwdgvagpgapidtdhwcaiatnvlggcrgstgpgslapdgkpwgsrf
pqitirdqvaadraalaalgitevaavvggsmggaralewlvthpddvraglvlavgara
tadqigtqstqvaaikadpdwqggdyhgtgraptegmeiarrfahltyrgeeelddrfan
tpqddedpltggryavqsyleyqggklarrfdpgtyvvlsdalsshdvgrgrggveaalr
scpvpvvvggitsdrlypirlqqelaellpgcqgldvvdsiyghdgflvetelvgklirr
tlelaqr

Timeline for d6ioib1:

• d6ioib1 first appeared in SCOPe 2.07