SCOPe 2.08: Domain d6kk8b_: 6kk8 B:

Lineage for d6kk8b_ (6kk8 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.3: Manganese catalase (T-catalase) [100951] (2 proteins)
   automatically mapped to Pfam PF05067

6. Protein automated matches [190575] (2 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:262724] [188041] (3 PDB entries)

8. Domain d6kk8b_: 6kk8 B: [373610]
   automated match to d2v8ta_
   complexed with dod, edo, mn3, o, so4

Details for d6kk8b_

PDB Entry: 6kk8, 1.37 Å

PDB Description: xn joint refinement of manganese catalase from thermus thermophilus hb27

PDB Compounds: (B:) pseudocatalase

SCOPe Domain Sequences for d6kk8b_:

Sequence; same for both SEQRES and ATOM records:

>d6kk8b_ a.25.1.3 (B:) automated matches {Thermus thermophilus [TaxId: 262724]}
mflridrlqielpmpkeqdpnaaaavqallggrfgemstlmnymyqsfnfrgkkalkpyy
dlianiateelghielvaatinsllaknpgkdleegvdpastplgfakdvrnaahfiagg
anslvmgamgehwngeyvftsgnlildllhnfflevaarthklrvyemtdnpvaremigy
llvrggvhaaaygkalesltgvemtkmlpipkidnskipeakkymdlgfhrnlyrfsped
yrdlgliwkgaspedgtevvvvdgpptggpvfdaghdaaefapefhpgelyeiakklyek

Timeline for d6kk8b_:

• d6kk8b_ first appeared in SCOPe 2.07